Analgesic effects of Phalfa1 beta toxin: a review of mechanisms of action involving pain pathways

Phα1ß is a neurotoxin purified from spider venom that acts as a high-voltage-activated (HVA) calcium channel blocker. This spider peptide has shown a high selectivity for N-type HVA calcium channels (NVACC) and an analgesic effect in several animal models of pain. Its activity was associated with a reduction in calcium transients, glutamate release, and reactive oxygen species production from the spinal cord tissue and dorsal ganglia root (DRG) in rats and mice. It has been reported that intrathecal (i.t.) administration of Phα1ß to treat chronic pain reverted opioid tolerance with a safer profile than ω-conotoxin MVIIA, a highly selective NVACC blocker. Following a recent development of recombinant Phα1ß (CTK 01512-2), a new molecular target, TRPA1, the structural arrangement of disulphide bridges, and an effect on glial plasticity have been identified. CTK 01512-2 reproduced the antinociceptive effects of the native toxin not only after the intrathecal but also after the intravenous administration. Herein, we review the Phα1ß antinociceptive activity in the most relevant pain models and its mechanisms of action, highlighting the impact of CTK 01512-2 synthesis and its potential for multimodal analgesia.

Analgesic effects of Phα1ß toxin: a review of mechanisms of action involving pain pathways

Phα1ß is a neurotoxin purified from spider venom that acts as a high-voltage-activated (HVA) calcium channel blocker. This spider peptide has shown a high selectivity for N-type HVA calcium channels (NVACC) and an analgesic effect in several animal models of pain. Its activity was associated with a reduction in calcium transients, glutamate release, and reactive oxygen species production from the spinal cord tissue and dorsal ganglia root (DRG) in rats and mice. It has been reported that intrathecal (i.t.) administration of Phα1ß to treat chronic pain reverted opioid tolerance with a safer profile than ω-conotoxin MVIIA, a highly selective NVACC blocker. Following a recent development of recombinant Phα1ß (CTK 01512-2), a new molecular target, TRPA1, the structural arrangement of disulphide bridges, and an effect on glial plasticity have been identified. CTK 01512-2 reproduced the antinociceptive effects of the native toxin not only after the intrathecal but also after the intravenous administration. Herein, we review the Phα1ß antinociceptive activity in the most relevant pain models and its mechanisms of action, highlighting the impact of CTK 01512-2 synthesis and its potential for multimodal analgesia.

The potential of plant and fungal proteins in the control of gastrointestinal nematodes from animals / Potencial de proteínas de plantas e fungos no controle de nematoides gastrintestinais de animais

Abstract Gastrointestinal nematode infection is an important cause of high economic losses in livestock production. Nematode control based on a synthetic chemical approach is considered unsustainable due to the increasing incidence of anthelmintic resistance. Control alternatives such as the use of natural products are therefore becoming relevant from an environmental and economic point of view. Proteins are macromolecules with various properties that can be obtained from a wide range of organisms, including plants and fungi. Proteins belonging to different classes have shown great potential for the control of nematodes. The action of proteins can occur at specific stages of the nematode life cycle, depending on the composition of the external layers of the nematode body and the active site of the protein. Advances in biotechnology have resulted in the emergence of numerous protein and peptide therapeutics; however, few have been discussed with a focus on the control of animal nematodes. Here, we discuss the use of exogenous proteins and peptides in the control of gastrointestinal.

Resumo A infecção por nematoides gastrintestinais é uma importante causa de grandes perdas econômicas na pecuária. O controle de nematoides com compostos químicos sintéticos é considerado insustentável devido ao aumento da resistência anti-helmíntica. Alternativas de controle, como o uso de produtos naturais, estão se tornando relevantes do ponto de vista ambiental e econômico. As proteínas são macromoléculas com várias propriedades que podem ser obtidas de uma ampla gama de organismos, incluindo plantas e fungos. Proteínas pertencentes a diferentes classes têm mostrado grande potencial para o controle de nematoides. A ação das proteínas pode ocorrer em estágios específicos do ciclo de vida do nematoide, dependendo da composição das camadas externas do parasito e do sítio ativo da proteína. Avanços na biotecnologia resultaram no surgimento de numerosas terapias de proteínas e peptídeos; no entanto, pouco foi discutido com foco no controle de nematoides parasitos de animais. Na presente revisão foi discutido o uso de proteínas exógenas e peptídeos no controle de nematoides gastrintestinais, os mecanismos sugeridos de ação, e os desafios e perspectivas para o uso dessas biomoléculas como uma classe de anti-helmínticos.

Purificación parcial de péptidos presentes en el veneno del escorpión Tityus macrochirus (Buthidae) y evaluación preliminar de su actividad citotóxica / Partial purification of peptides present in the Tityus macrochirus (Buthidae) scorpion venom and preliminary assessment of their cytotoxicity

RESUMEN Introducción. El veneno del escorpión posee péptidos con actividad neurotóxica que actúan principalmente en los canales iónicos del sistema nervioso de insectos y mamíferos. También se ha establecido su acción citolítica y anticancerígena, características biológicas que aún no se han explorado en el veneno del escorpión Tityus macrochirus. Objetivo. Evaluar si tanto el veneno total de T. macrochirus como la fracción de péptidos parcialmente purificados disminuyen el porcentaje de viabilidad de diferentes líneas celulares provenientes de tumores. Materiales y métodos. Mediante métodos cromatográficos, electroforéticos y de ultrafiltración con membranas de Amicon Ultra 0.5®, se identificaron y purificaron parcialmente los péptidos del veneno de T. macrochirus obtenido mediante estimulación eléctrica. Los ensayos de actividad citotóxica del veneno y de la fracción de péptidos se hicieron en líneas celulares provenientes de tumores con el método colorimétrico de reducción de la sal de tetrazolio (Mossman's Tetrazole Test, MTT). Resultados. El veneno de T. macrochirus posee péptidos con pesos moleculares entre 3 y 10 kDa, los cuales se purificaron parcialmente mediante ultrafiltración y se evaluaron mediante cromatografía líquida de alta resolución en fase inversa (Reverse Phase-High Pressure Liquid Chromatography, RP-HPLC). Los ensayos de citotoxicidad del veneno total de T. macrochirus evidenciaron una mayor disminución de la viabilidad en la línea celular PC3 que en las demás líneas celulares evaluadas, en tanto que la fracción parcialmente purificada de péptidos logró disminuir la viabilidad de la línea celular HeLa. Conclusión. Los péptidos del veneno de T. macrochirus presentaron actividad citotóxica en algunas de las líneas celulares provenientes de tumores, y se observó algún grado de selectividad frente a ellas.

ABSTRACT Introduction: Scorpion venom contains peptides with neurotoxic action primarily active on ion channels in the nervous system of insects and mammals. They are also characterized as cytolytic and anticancer, biological characteristics that have not yet been reported for the Tityus macrochirus venom. Objective: To assess if the total T. macrochirus venom and the fraction of partially purified peptides decrease the viability of various tumor-derived cell lines. Materials and methods: The scorpion venom was collected by electrical stimulation and, subsequently, subjected to chromatography, electrophoresis, and ultrafiltration with Amicon Ultra 0.5® membranes for the partial identification and purification of its peptides. The cytotoxic activity of the venom and the peptides fraction trials on tumor-derived cell lines were carried out by the MTT method. Results: The T. macrochirus scorpion venom has peptides with molecular weights ranging between 3 and 10 kDa. They were partially purified using the ultrafiltration technique, and assessed by the RP-HPLC method. Cytotoxicity trials with the whole T. macrochirus venom showed a higher viability decrease on the PC3 cell line compared to the other cell lines assessed, while the partially purified peptides decreased the HeLa cell line viability. Conclusion: Peptides in the T. macrochirus scorpion venom showed cytotoxic activity on some tumor-derived cell lines. We observed some degree of selectivity against other cell lines assessed.

Isolation and biochemical characterization of bradykinin-potentiating peptides from Bitis gabonica rhinoceros

Background: Venoms represent a still underexplored reservoir of bioactive components that might mitigate or cure diseases in conditions in which conventional therapy is ineffective. The bradykinin-potentiating peptides (BPPs) comprise a class of angiotensin-I converting enzyme (ACE) inhibitors. The BPPs usually consist of oligopeptides with 5 to 13 residues with a high number of proline residues and the tripeptide Ile-Pro-Pro (IPP-tripeptide) in the C-terminus region and have a conserved N-terminal pyroglutamate residue. As a whole, the action of the BPPs on prey and snakebite victims results in the decrease of the blood pressure. The aim of this work was to isolate and characterize novel BPPs from the venom of Bitis gabonica rhinoceros. Methods: The crude venom of B. g. rhinoceros was fractionated by size exclusion chromatography and the peptide fraction (<7 kDa) was separated by reverse phase chromatography (RP-HPLC) and analyzed by ESI-IT-TOF-MS/MS. One new BPP was identified, synthetized and assayed for ACE inhibition and, in vivo, for edema potentiation. Results: Typical BPP signatures were identified in three RP-HPLC fractions. CID fragmentation presented the usual y-ion of the terminal P-P fragment as a predominant signal at m/z 213.1. De novo peptide sequencing identified one Bothrops-like BPP and one new BPP sequence. The new BPP was synthesized and showed poor inhibition over ACE, but displayed significant bradykinin-induced edema potentiation. Conclusions: So far, few BPPs are described in Viperinae, and based on the sequenced peptides, two non-canonical sequences were detected. The possible clinical role of this new peptides remains unclear.(AU)

Cloning and purification of the first termicin-like peptide from the cockroach Eupolyphaga sinensis

Abstract Background Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects. Methods The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests. Results A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 μg/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 μg/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 μg/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera). Conclusions This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea. Our results demonstrate the diversity of termicin-like peptides, as well as antimicrobial peptides in insects.(AU)

Desenvolvimento e padronização do Dot-ELISA usando peptídeos recombinantes para o diagnóstico sorológico de Neospora caninum / Development and standardization of Dot-ELISA using recombinant peptides for serological diagnosis of Neospora caninum

A neosporose é reconhecida como uma das maiores causas de aborto e perdas neonatais em bovinos de leite e corte em todo o mundo. Nos últimos anos esta doença tem atraído o interesse de pesquisadores com foco na epidemiologia e métodos eficazes de diagnóstico desta doença. No presente estudo objetivou-se desenvolver e padronizar um teste Dot-ELISA para o diagnóstico sorológico de Neospora caninum com um peptídeo recombinate como antígeno, visando o desenvolvimento de um kit para diagnóstico a campo. O peptídeo recombinante (rNcGRA1) foi desenhado com base na metodologia de genética reversa de epítopos antigênicos originados de uma proteína de grânulos densos de N. caninum, e sintetizado pela GenScript (USA). Produzido mediante o processo fermentativo em leveduras Pichia pastoris KM71. Para a padronização do Dot-ELISA, membranas de nitrocelulose de 0.22µm foram sensibilizadas com 1µL do antígeno e posteriormente os soros foram diluídos em solução de lavagem e incubados durante 1 hora. A revelação foi feita mediante a adição de Proteína G marcada com peroxidase por 30 minutos, seguido da solução reveladora a base de 3,3’-Diaminobenzidine (DAB). Logo após a padronização foram testados 44 soros bovinos diagnosticados por imunofluorescência indireta (RIFI), obtendo-se uma concordância nos resultados do teste de 95,5% e uma sensibilidade e especificidade de 100% e 92% respectivamente. Quanto ao Kit para diagnóstico a campo na Plataforma Tecnológica RapidFlow-Through Miriad®, o peptídeo rNcGRA1 apresentou marcações visíveis ao reagir com os soros positivos, e não apresentou marcações usando os soros negativos. Este estudo é o primeiro a utilizar peptídeos recombinantes e mostrar-se eficiente para o diagnóstico sorológico de bovinos naturalmente infetados por N. caninum...

Neosporosis is recognized as a major cause of abortion and neonatal loss in cattle worldwide, both for dairy cattle and beef cattle. In recent years this disease has attracted the interest of researchers and studying the epidemiology and effective methods of diagnosis of this disease. The present study aimed to develop and standardize on a Dot-ELISA for the serological diagnosis of Neospora caninum by using recombinant peptide as antigen for the development of a diagnostic kit used on the field. The recombinant antigen (rNcGRA1) was designed based on the method of reverse genetics derived antigenic epitopes of dense granules protein of N. caninum and synthesized by GenScript (USA). It was produced by the fermentation in yeasts Pichiapastoris KM71. The serological technique was used for the Dot-ELISA detection of IgG specific for N. caninum in which 0.22μm nitrocellulose membranes were sensitized with 1μL of antigen and subsequently the plasmas were diluted in a washing solution and incubated for 1 hour. The results will revealed by the addition of Protein G labeled with peroxidasse for 30 minutes, followed by the developing solution based on 3,3’-Diaminobenzidine (DAB). Soon after standardization tested 44 bovine plasmas were diagnosed by indirect immunofluorescence assay (IFA), agreeing with the results on a 95.5% and a sensitivity and specificity of 100% and 92% respectively. In regard to the diagnostic kit for the Technology Platform Rapid Flow-Through Miriad®, the peptide presented rNcGRA1 visible markings to react with positive plasma, and showed no markings using the negative plasma. This study is the first to use recombinant peptides and prove to be efficient for the serological diagnosis of cattle naturally infected...

Detection of cheese whey and caseinomacropeptide in fermented milk beverages using high performance liquid chromatography / Detecção de soro lácteo e caseinomacropeptídeo por cromatografia líquida de alta eficiência em bebidas lácteas fermentadas

Cheese whey level and caseinomacropeptide (CMP) index of fermented milk beverages added with four levels of cheese whey (0, 10, 20, and 40percent) and stored at 8-10oC for 0, 7, 14 and 21 days were determined by high performance liquid chromatography-gel filtration (HPLC-GF). Additionally, the interference of the starter culture and the storage time on the detection of cheese whey and CMP were investigated. Refrigerated storage up to 21 days did not affect (P>0.05) cheese whey and CMP amounts in milk (0 percent of cheese whey) and in fermented milk beverages added with 10 and 20percent of cheese whey (P>0.05). However, cheese whey and CMP amounts were higher than expected (P<0.05) in fermented milk beverages added with 40 percent of cheese whey and stored for 21 days...

O presente trabalho teve como objetivos quantificar o teor de soro e o índice de caseinomacropeptídeo (CMP) de bebidas lácteas fermentadas preparadas em laboratório, adicionadas de diferentes concentrações de soro (0, 10, 20 e 40 por cento), fermentadas e armazenadas em refrigeração (8-10oC) por tempos distintos (zero, sete, 14 e 21 dias), por cromatografia líquida de alta eficiência-filtração em gel (CLAE-FG), bem como verificar a interferência da cultura utilizada no preparo das bebidas lácteas fermentadas e do tempo de armazenamento na detecção de soro lácteo e CMP. Quando os teores de soro lácteo e os índices de CMP obtidos por CLAE-FG de bebidas lácteas fermentadas foram analisados ao longo do tempo de armazenamento, verificou-se que não houve diferença (p>0,05) para o leite (0 por cento de soro) e as bebidas lácteas com 10 e 20 por cento de soro nos tempos de zero, sete, 14 e 21 dias de armazenamento. No entanto, para a bebida láctea fermentada adicionada de 40 por cento de soro, foi observada diferença para o tempo de armazenamento de 21 dias (p<0,05), em que o teor de soro e o índice de CMP obtidos foram maiores que os demais, que se mostraram equivalentes entre si (p>0,05) para os tempos de zero, sete e 14 dias...

Production of polypeptide antibiotic from Streptomyces parvulus and its antibacterial activity

A highly potent secondary metabolite producing actinomycetes strain is isolated from marine soil sediments of Visakhapatnam sea coast, Bay of Bengal. Over all ten strains are isolated from the collected soil sediments. Among the ten actinomycetes strains the broad spectrum strain RSPSN2 was selected for molecular characterization, antibiotic production and its purification. The nucleotide sequence of the 1 rRNA gene (1261 base pairs) of the most potent strain evidenced a 96% similarity with Streptomyces parvulus 1044 strain, Streptomyces parvulus NBRC 13193 and Streptomyces parvulus BY-F. From the taxonomic features, the actinomycetes isolate RSPSN2 matches with Streptomyces parvulus in the morphological, physiological and biochemical characters. Thus, it was given the suggested name Streptomyces parvulus RSPSN2. The active metabolite was extracted using ethyl acetate (1:3, v/v) at pH 7.0. The separation of active ingredient and its purification was performed by using both thin layer chromatography (TLC) and column chromatography (CC) techniques. Spectrometric studies such as UV-visible, FTIR, and NMR and mass were performed. The antibacterial activity of pure compound was performed by cup plate method against some pathogenic bacteria including of streptomycin resistant bacteria like (Pseudomonas mirabilis. Pseudomonas putida and Bacillus cereus). In conclusion, the collected data emphasized the fact that a polypeptide antibiotic (Actinomycin D) was produced by Streptomyces parvulus RSPSN2.

Synapsin-1 and tau reciprocal O-GlcNAcylation and phosphorylation sites in mouse brain synaptosomes

O-linked N-acetylglucosamine (O-GlcNAc) represents a key regulatory post-translational modification (PTM) that is reversible and often reciprocal with phosphorylation of serine and threonine at the same or nearby residues. Although recent technical advances in O-GlcNAc site-mapping methods combined with mass spectrometry (MS) techniques have facilitated study of the fundamental roles of O-GlcNAcylation in cellular processes, an efficient technique for examining the dynamic, reciprocal relationships between O-GlcNAcylation and phosphorylation is needed to provide greater insights into the regulatory functions of O-GlcNAcylation. Here, we describe a strategy for selectively identifying both O-GlcNAc- and phospho-modified sites. This strategy involves metal affinity separation of O-GlcNAcylated and phosphorylated peptides, beta-elimination of O-GlcNAcyl or phosphoryl functional groups from the separated peptides followed by dithiothreitol (DTT) conjugation (BEMAD), affinity purification of DTT-conjugated peptides using thiol affinity chromatography, and identification of formerly O-GlcNAcylated or phosphorylated peptides by MS. The combined metal affinity separation and BEMAD approach allows selective enrichment of O-GlcNAcylated peptides over phosphorylated counterparts. Using this approach with mouse brain synaptosomes, we identified the serine residue at 605 of the synapsin-1 peptide, 603QASQAGPGPR612, and the serine residue at 692 of the tau peptide, 688SPVVSGDTSPR698, which were found to be potential reciprocal O-GlcNAcylation and phosphorylation sites. These results demonstrate that our strategy enables mapping of the reciprocal site occupancy of O-GlcNAcylation and phosphorylation of proteins, which permits the assessment of cross-talk between these two PTMs and their regulatory roles.

Peptídeos antimicrobianos do veneno de Avicularia juruensis (Mygalomorphae, Theraphosidae) / Antimicrobial peptides venom Avicularia juruensis (Mygalomorphae, Theraphosidae)

Peptídeos Antimicrobianos (PAMs) são os principais elementos da imunidade inata contra bactérias e fungos em ambos os reinos: animal e vegetal. PAMs são um grupo extremamente diversificado de pequenas proteínas e sua função é essencial para a resposta imunológica dos organismos. Venenos animais são boas fontes de substâncias antimicrobianas, pois contêm um grande número de diferentes componentes biologicamente ativos de diferentes estruturas químicas, tais como proteínas, polipeptídeos e aminas. Toxinas que apresentam o nó cistina (CKTs) em venenos de aranhas representam uma rica fonte de novos ligantes para canais iônicos, e estão entre os constituintes mais estudados de venenos de aranha. Eles são moléculas pequenas, compactas ligadas por três a cinco pontes de dissulfeto, assegurando uma maior estabilidade na conformação da molécula que a contém, e, portanto, oferece um elevado potencial para aplicações na engenharia de proteínas. O nó d cistina ocorre numa grande variedade de peptídeos e proteínas e é relativamente comum em pequenas toxinas ricas em cisteína e pequenos peptídeos, com massas moleculares variando de 3,5 a 7 kDa. As toxinas que contêm o nó de cistina possuem uma alta gama de atividades biológicas, como atividade antimicrobiana, anti-HIV e bloqueio de canais iônicos. Este estudo teve como principal objetivo a caracterização do veneno e a identificação e caracterização de moléculas bioativas presentes no veneno da aranha caranguejeira Avicularia juruensis (Mygalomorphae, Theraphosidae), em especial peptídeos antimicrobianos. O veneno foi obtido por estimulação elétrica, diluído em água acidificada (TFA – ácido trifluoracético 0,05%) e centrifugado. A parte solúvel foi submetida à cromatografia líquida de alta eficiência (CLAE) em uma coluna semi preparativa Júpiter C18 de fase reversa. A presença de atividade antimicrobiana foi determinada por ensaio líquido de inibição de crescimento...

Characterization of low molecular weight antimicrobial peptide from human female reproductive tract.

Background & objectives: The mechanisms that protect female upper genital tract from ascending infection by microbes present in vagina are only partially understood. It is expected that epithelial cells in mucosal surfaces and their secretions directly interfere with microbial colonization and invasion. This study was aimed to demonstrate the expression of 2 kDa antimicrobial peptide which was identified and purified from female genital tract tissues using chromatographic techniques. Methods: Low molecular weight proteins were isolated from human female reproductive tract tissues obtained from premenopausal women. Antimicrobial activity of these LMW proteins was assessed against different reproductive tract pathogens viz., Neisseria gonorrhoeae, Group B streptococcus, Gardnerella vaginalis, Escherechia coli and Candida albicans. The expression of these peptides were also documented in reproductive tract tissues with the help of hyperimmune sera raised against the rabbits. The purified peptide was characterized by N-terminal sequencing. Results: Immunohistochemical and immunofluorescence studies demonstrated that 2 kDa peptide was expressed in the stratified squamous epithelial cells of the ectocervix while it was absent in columnar epithelial cells of upper genital tract. Upregulation of the expression of this peptide was observed in patients of chronic non-specific cervicitis and acute on chronic cervicitis. This purified antimicrobial peptide also showed broad spectrum antimicrobial activity against different reproductive tract pathogens. Interpretation & conclusions: Considering the emerging bacterial resistance against conventional antibiotics, isolation and understanding of the expression of antimicrobial peptides from female reproductive tissue extracts may provide some leads towards the development of strategies for the treatment of reproductive tract infections.

Purificação e caracterização de peptídeos antimicrobianos presentes na hemolinfa de Acanthoscurria rondoniae (Mygalomorphae, Theraphosidae) / Purification and characterization of antimicrobial peptides in the Haemilymph of the Acanthoscurria rondoniae spider( Mygalomorphae, Theraphosidae

Todos os organismos vivos, abrangendo desde microrganismos até plantas e animais, evoluíram de forma a desenvolver mecanismos para ativamente defender-se contra o ataque de patógenos. Peptídeos antimicrobianos são importantes componentes do sistema imune dos vertebrados e invertebrados podendo ser agrupados de acordo com suas propriedades químicas e estruturais. Podem agir na membrana plasmática de microorganismos formando poros na bicamada de fosfolipídeos ou serem internalizados e atuar sobre alvos intracelulares. Estudos sobre a biodiversidade de moléculas antimicrobianas nos vários grupos de artrópodes podem ser importantes para se entender o processo imunológico de uma maneira mais ampla, possibilitando compreender as relações existentes entre os vários sistemas, bem como sua origem, além de poder contribuir para o desenvolvimento e utilização de novas drogas para o uso na medicina e na agricultura. O objetivo deste trabalho foi verificar a produção de substâncias antimicrobianas, como observada em outros artrópodes, utilizando a aranha Acanthoscurria rondoniae como exemplo, através da purificação e caracterização de moléculas presentes na hemolinfa e caracterizando-as para um entendimento mais amplo dos processos envolvidos no sistema imune de aracnídeos e dos artrópodes em geral. Neste trabalho foram encontradas três frações com atividade antimicrobiana nos hemócitos que apresentaram massa molecular de 2.270,3 Da, 418,2 Da e 10.111,8 Da, respectivamente. Essas massas quando comparadas as encontradas em A. gomesiana, mostram similaridade com a gomesina, mygalina e acanthoscurrina, podendo indicar que as duas espécies apresentam as mesmas moléculas antimicrobianas em seus hemócitos. No plasma, foram encontradas seis frações, mais somente uma foi caracterizada, que apresentou massa molecular de 1.236,776 Da, recebeu o nome de rondonina em homenagem a espécie estudada. Pela primeira vez foi observado...

Induction of a gloverin-like antimicrobial polypeptide in the sugarcane borer Diatraea saccharalis challenged by septic injury

Diatraea saccharalis (Fabricius, 1794) (Lepidoptera: Crambidae) is an important pest for Brazilian sugarcane. In the present study, we detected two distinct spots in hemolymph from septic injured larvae (HDs1 and HDs2), which are separated by 2DE gel electrophoresis. Both spots were subjected to in-gel tryptic digestion and MALDI-TOF/TOF analysis, which revealed the sequence VFGTLGSDDSGLFGK present in both HDs1 and HDs2. This sequence had homology and 80 percent identity with specific Lepidoptera antimicrobial peptides called gloverins. Analyses using the ImageMaster 2D software showed pI 8.94 of the HDs1 spot, which is similar to that described to Hyalophora gloveri gloverin (pI 8.5). Moreover, the 14-kDa molecular mass of the spot HDs1 is compatible to that of gloverins isolated from the hemolymph of Trichoplusia ni, Helicoverpa armigera and H. gloveri. Antimicrobial assays with partially purified fractions containing the HDs1 and HDs2 polypeptides demonstrated activity against Escherichia coli. This is the first report of antimicrobial polypeptides in D. saccharalis, and the identification of these peptides may help in the generation of new strategies to control this pest.

Action of plant proteinase inhibitors on enzymes of physiopathological importance

Obtained from leguminous seeds, various plant proteins inhibit animal proteinases, including human, and can be considered for the development of compounds with biological activity. Inhibitors from the Bowman-Birk and plant Kunitz-type family have been characterized by proteinase specificity, primary structure and reactive site. Our group mostly studies the genus Bauhinia, mainly the species bauhinioides, rufa, ungulata and variegata. In some species, more than one inhibitor was characterized, exhibiting different properties. Although proteins from this group share high structural similarity, they present differences in proteinase inhibition, explored in studies using diverse biological models.

Obtidas de sementes leguminosas, várias proteínas inibem proteinases de origem animal, incluindo humanas, e podem ser consideradas para o desenvolvimento de compostos com atividade biológica. Inibidores da família Bowman-Birk e da família Kunitz vegetal tem sido caracterizados em relação a especificidade para proteinase, estrutura primária e sitio reativo. O nosso grupo majoritariamente vem estudando o gênero Bauhinia, principalmente as espécies bauhinioides, rufa, ungulatae variegata. Em algumas espécies, mais de um inibidor com propriedades diferentes foi caracterizado. Embora tais proteínas apresentem alta similaridade estrutural, diferem quanto à inibição de proteinases, e foram exploradas em estudos utilizando diversos modelos biológicos.

O sistema nervoso central como alvo das ações anti-hipertensivas de um peptídeo rico em resíduos de prolina do veneno da Bothrops jararaca / The central nervous system as target for anti-hypertensive actions of proline-rich peptide from Bothrops jararaca venom

Os peptídeos potenciadores da bradicinina (BPPs) presentes no veneno da serpente Bothrops jararaca são oligopeptídeos ricos em prolinas. Eles foram os primeiros inibidores naturais da enzima conversora de angiotensina (ECA) descritos. As propriedades bioquímicas e farmacológicas desses peptídeos foram essenciais para o desenvolvimento do captopril, o primeiro inibidor sítio-dirigido da ECA, usado para tratar a hipertensão humana. Recentes dados têm sugerido que a atividade farmacológica dos BPPs não pode ser explicada somente pela ação inibitória da atividade da ECA e que os efeitos dos BPPs devem envolver a participação do sistema nervoso central (SNC). Nesse trabalho foi caracterizada a sinalização de Ca2+ induzida pelo BPP-lOc [

Identificação e validação de um novo alvo funcional de um peptideo com atividade anti-hipertensiva do veneno da Bothrops jararaca / Identification and validation of a novel functional target of a peptide from Bothrops jararaca venom with anti-hypertensive activity

O BPP-10c é um decapeptídeo bioativo, rico em resíduos de prolina e é expresso em uma proteína precursora no cérebro e na glândula de veneno da Bothrops jararaca. Recentemente demonstramos que o BPP-10c tem um potente e sustentado efeito anti-hipertensivo em ratos espontaneamente hipertensos (SHR), sem, no entanto, causar qualquer efeito em ratos normotensos, por um mecanismo farmacológico independente da inibição da enzima conversora de angiotensina (ECA), levando à hipótese de que outro mecanismo poderia estar envolvido na atividade do peptídeo. Neste trabalho, usamos cromatografia de afinidade para isolar e identificar as proteínas renais com afinidade pelo BPP-10c e demonstramos que a argininosuccinato sintase (AsS) é a principal proteína a se ligar ao peptídeo. Além disso, mostramos que essa interação promove um aumento na atividade catalítica da enzima, de forma dose-dependente. A AsS é reconhecida como uma peça chave na regulação do ciclo da citrulina-óxido nítrico (NO), e sua ação é passo limitante na síntese de NO...

Alterations in polypeptides pattern in malaria vector Anopheles stephensi, fed upon immunized blood causing fecundity reduction.

Changes in polypeptides pattern of haemolymph, midgut, ovary and salivary glands of female mosquito A. stephensi were studied when fed upon anti-mosquito haemolymph antibodies. The expression of almost all polypeptides was reduced in haemolymph and ovary of the immune fed mosquitoes as compared to control. However, there was no significant difference in case of midgut and salivary glands. Seven polypeptides 100, 90, 84, 80, 62, 19 and 12.5 kDa were absent in haemolymph and five 92, 90, 80, 60 and 55 kDa were absent in ovaries. Changes in the polypeptide pattern have been correlated with the fecundity reduction due to immunized blood feeding.

Peptídeos mitogênicos ou inibidores da atividade do Fator de Crescimento de Fibroblastos-1 humano baseados no complexo FGF/receptor/heparina / Mitogenic peptides or inhibitors of the human Fibroblast Growth Factor-1 activity based on the complex FGF/receptor/heparin

Os Fatores de Crescimento de Fibroblastos (®Fibroblast Growth Factors¼; FGFs) participam de fenômenos biológicos de grande importância, tais como migração, divisão e diferenciação celulares. O presente trabalho teve como objetivo central a busca de compostos biologicamente ativos através de um desenho racional de peptídeos derivados do FGF-1 e do seu receptor (FGFR-1). A partir da análise dos dados disponíveis na literatura, aliada a técnicas de modelagem molecular, foram desenhados, sintetizados e testados dois grupos de peptídeos. O primeiro conjunto (R1 - R3) é constituído por peptídeos lineares derivados do FGFR-1. Os ensaios de atividade mitogênica dos FGFs 1 e 2 em presença dos peptídeos mostram que R1 e R2 foram capazes de inibir a ação mitogênica do FGF-1...

Loss of a putative novel growth inhibitory apoptotic 14 kD polypeptide during progression of rat liver carcinogenesis.

Carcinogenesis is a multistep process involving different stages. However, the biological and biochemical factors responsible for the stepwise transition of cells from one stage to the other remains as important enigmas even today. We have recently isolated a putative novel growth inhibitory apoptotic 14 kD polypeptide from normal rat liver. In order to understand the possible functional relationship between 14 kD polypeptide and liver carcinogenesis, the sequential expression of this polypeptide as a function of tumor progression was studied in the rat liver using diethylnitrosamine (DEN) as a carcinogen. Immunoperoxidase and immunoblotting experiments using polyclonal rabbit antisera revealed a gradual reduction in the levels of this polypeptide with tumor progression. No reduction in the levels of this polypeptide was observed in regenerating rat liver after partial hepatectomy. The findings suggest that the loss or reduction of 14 kD polypeptide is linked selectively to abnormal cell proliferation and appears to be a biologically relevant risk factor for the progression of hepatocarcinogenesis in rats.